PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS60753.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB_related
Protein Properties Length: 82aa    MW: 9396.44 Da    PI: 11.7642
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS60753.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.7e-141256347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT++E++l++ + +++G g+W++I+r + k+R++ q+ s+ qky
       EPS60753.1 12 PWTQDEHKLFLIGLERFGRGDWRSISRNVVKTRSPTQVASHAQKY 56
                     7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-10560IPR009057Homeodomain-like
PROSITE profilePS5129416.778561IPR017930Myb domain
SuperFamilySSF466895.91E-17761IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-16859IPR006447Myb domain, plants
SMARTSM007171.8E-8959IPR001005SANT/Myb domain
CDDcd001671.14E-81257No hitNo description
PfamPF002499.8E-121256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 82 aa     Download sequence    Send to blast
SRAGDERKKG IPWTQDEHKL FLIGLERFGR GDWRSISRNV VKTRSPTQVA SHAQKYFQRN  60
RSGGDSSSNG KQRKRSSIHD IT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084236.11e-33PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-32DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLS8DD693e-54S8DD69_9LAMI; Uncharacterized protein (Fragment)
STRINGMLOC_20277.16e-34(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52342032
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-33MYB family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]